missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RAP1A Polyclonal antibody specifically detects RAP1A in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Spécification
Spécification
| Antigène | RAP1A |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | DyLight 550 |
| Formule | 50mM Sodium Borate |
| Alias de gène | C21KG, G-22K, GTP-binding protein smg p21A, KREV-1, KREV1Ras-related protein Krev-1, RAP1, RAP1A, member of RAS oncogene family, ras-related protein Rap-1A, RAS-related protein RAP1A, SMGP21 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 39-138 of human RAP1A (NP_002875.1).,, Sequence:, SYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQW |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?