missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RhoC Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™
Tous les produits Bio Techne ProduitsDescription
RhoC Polyclonal antibody specifically detects RhoC in Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Spécification
Spécification
| Antigène | RhoC |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Alexa Fluor 488 |
| Formule | 50mM Sodium Borate |
| Alias de gène | ARH9ARHCRho cDNA clone 9, H9, MGC1448, MGC61427, oncogene RHO H9, ras homolog gene family, member C, RAS-related homolog 9, RhoC, rhoC GTPase, RHOH9, rho-related GTP-binding protein RhoC, small GTP binding protein RhoC |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoC (NP_786886.1).,, Sequence:, NIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?