missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 30498263

GBF1 Antibody [Alexa Fluor« 532], Novus Biologicals Biologicals™

Product Code. 30498263 Shop All Bio Techne Products
Change view
Click to view available options
Quantité:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité unitSize
30498263 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498263 Supplier Novus Biologicals Supplier No. NBP335248AF532
 Article restreint
Expédition estimée: 31-08-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GBF1 Polyclonal antibody specifically detects GBF1 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigène GBF1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué Alexa Fluor 532
Formule 50mM Sodium Borate
Alias de gène ARF1GEF, BFA-resistant GEF 1, FLJ21263, golgi brefeldin A resistant guanine nucleotide exchange factor 1, golgi-specific brefeldin A resistance factor 1, Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1, KIAA0248FLJ21500, MGC134877, MGC134878
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1).,, Sequence:, MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 8729
Espèces cibles Human, Mouse
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.