missing translation for 'onlineSavingsMsg'
Learn More

HLA A Antibody [PE], Novus Biologicals Biologicals™

Code produit 30498301 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité
30498301 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498301 Fournisseur Novus Biologicals Code fournisseur NBP337966PE
 Article restreint
Expédition estimée: 01-09-2026
Ajouter au panier
Ajouter au panier
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

HLA A Polyclonal antibody specifically detects HLA A in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène HLA A
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué PE
Formule PBS
Alias de gène A-10 alpha chain, FLJ26655, HLA class I histocompatibility antigen, A-1 alpha chain, HLA class I histocompatibility antigen, A-28 alpha chain, HLA class I histocompatibility antigen, A-9 alpha chain, HLAA, major histocompatibility complex, class I, A, MHC class I antigen A*1, MHC class I antigen A*11, MHC class I antigen A*80
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 35-285 of human HLA A (NP_002107.3).,, Sequence:, GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Adaptive Immunity, Cell Biology, Immunology
Primaire ou secondaire Primary
Identification génétique (Entrez) 3105
Espèces cibles Human, Mouse
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.