missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ILF1 Polyclonal antibody specifically detects ILF1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antigène | ILF1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugué | PE |
| Formule | PBS |
| Alias de gène | Cellular transcription factor ILF-1, forkhead box K2, forkhead box protein K2, FOXK1, ILF-1, ILF1ILF, interleukin enhancer binding factor 1, Interleukin enhancer-binding factor 1 |
| Espèces hôtes | Rabbit |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human ILF1 (NP_004505.2).,, Sequence:, TPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEARFAQSAPGSPL |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?