missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 30498344

Hemoglobin beta Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Product Code. 30498344 Shop All Bio Techne Products
Change view
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité
30498344 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498344 Supplier Novus Biologicals Supplier No. NBP335330APC
 Article restreint
Expédition estimée: 01-09-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Hemoglobin beta Polyclonal antibody specifically detects Hemoglobin beta in Human,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigène Hemoglobin beta
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué APC
Formule PBS
Alias de gène beta globin chain, beta-globin, CD113t-C, HBBB, HBD, Hemoglobin beta chain, hemoglobin subunit beta, hemoglobin, beta
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 47-147 of human Hemoglobin beta (NP_000509.1).,, Sequence:, GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 3043
Espèces cibles Human, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.