missing translation for 'onlineSavingsMsg'
Learn More

TRPC1 Antibody [DyLight 550], Novus Biologicals Biologicals™

Code produit 30498406 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30498406 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498406 Fournisseur Novus Biologicals Code fournisseur NBP335247R
 Article restreint
Expédition estimée: 31-08-2026
Ajouter au panier
Ajouter au panier
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

TRPC1 Polyclonal antibody specifically detects TRPC1 in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène TRPC1
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué DyLight 550
Formule 50mM Sodium Borate
Alias de gène HTRP-1, MGC133334, MGC133335, transient receptor potential canonical 1, transient receptor potential cation channel, subfamily C, member 1, transient receptor potential channel 1, Transient receptor protein 1, TRP-1, TRP1short transient receptor potential channel 1, TrpC1
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (NP_001238774.1).,, Sequence:, LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cardiovascular Biology, Neuroscience, Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 7220
Espèces cibles Human, Mouse
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.