missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TRPC1 Polyclonal antibody specifically detects TRPC1 in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Spécification
Spécification
| Antigène | TRPC1 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | DyLight 550 |
| Formule | 50mM Sodium Borate |
| Alias de gène | HTRP-1, MGC133334, MGC133335, transient receptor potential canonical 1, transient receptor potential cation channel, subfamily C, member 1, transient receptor potential channel 1, Transient receptor protein 1, TRP-1, TRP1short transient receptor potential channel 1, TrpC1 |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (NP_001238774.1).,, Sequence:, LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?