missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 30498713

GBF1 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™

Code produit 30498713 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30498713 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498713 Fournisseur Novus Biologicals Code fournisseur NBP335248JF525

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

GBF1 Polyclonal antibody specifically detects GBF1 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène GBF1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué Janelia Fluor 525
Formule 50mM Sodium Borate
Alias de gène ARF1GEF, BFA-resistant GEF 1, FLJ21263, golgi brefeldin A resistant guanine nucleotide exchange factor 1, golgi-specific brefeldin A resistance factor 1, Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1, KIAA0248FLJ21500, MGC134877, MGC134878
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1).,, Sequence:, MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 8729
Espèces cibles Human, Mouse
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.