missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Xanthine Oxidase Antibody [DyLight 488], Novus Biologicals Biologicals™
Tous les produits Bio Techne ProduitsDescription
Xanthine Oxidase Polyclonal antibody specifically detects Xanthine Oxidase in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antigène | Xanthine Oxidase |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugué | DyLight 488 |
| Formule | 50mM Sodium Borate |
| Alias de gène | EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 985-1084 of human Xanthine Oxidase (XDH) (NP_000370.2).,, Sequence:, CIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILK |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?