missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 30498826

CYBB/NOX2 Antibody [DyLight 594], Novus Biologicals Biologicals™

Code produit 30498826 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité
30498826 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498826 Fournisseur Novus Biologicals Code fournisseur NBP335663DL594

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

CYBB/NOX2 Polyclonal antibody specifically detects CYBB/NOX2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spécification

Antigène CYBB/NOX2
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugué DyLight 594
Formule 50mM Sodium Borate
Alias de gène CGD, CGD91-phox, Cytochrome b(558) subunit beta, cytochrome b-245 heavy chain, cytochrome b-245, beta polypeptide, Cytochrome b558 subunit beta, EC 1.6.3, GP91-1, GP91PHOX, GP91-PHOX, Heme-binding membrane glycoprotein gp91phox, NADPH oxidase 2, Neutrophil cytochrome b 91 kDa polypeptide, NOX2chronic granulomatous disease, p22 phagocyte B-cytochrome, p91-PHOX, Superoxide-generating NADPH oxidase heavy chain subunit
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 385-570 of human CYBB/NOX2 (NP_000388.2).,, Sequence:, FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cancer, Endocrinology, Immunology
Primaire ou secondaire Primary
Identification génétique (Entrez) 1536
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.