missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ APOA1 (Human) Recombinant Protein

Human APOA1 full-length ORF ( AAH05380, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00000335-P01.10ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16121701

  • 310.00€ / 10µg

Expédition estimée
31-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Spécification

Spécification

AAH05380
apolipoprotein A-I
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APOA1
GST
335
Wheat germ expression system
10 μg
MGC117399
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents