missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ATP5O (Human) Recombinant Protein
Human ATP5O full-length ORF ( AAH21233, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
Marque: Abnova™ H00000539-P01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
- Sequence: MAAPAVSGLSRQVRCLSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Spécification
| AAH21233 | |
| ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ATP5O | |
| GST |
| 539 | |
| Wheat germ expression system | |
| 25 μg | |
| ATPO, OSCP | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |