missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ATP5O (Human) Recombinant Protein

Human ATP5O full-length ORF ( AAH21233, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00000539-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16122091

  • 467.00€ / 25µg

Expédition estimée
22-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MAAPAVSGLSRQVRCLSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Spécification

Spécification

AAH21233
ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATP5O
GST
539
Wheat germ expression system
25 μg
ATPO, OSCP
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents