missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CFL1 (Human) Recombinant Protein

Human CFL1 full-length ORF ( AAH11005, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00001072-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16126224

  • 467.00€ / 25µg

Expédition estimée
30-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Spécification

Spécification

AAH11005
cofilin 1 (non-muscle)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CFL1
GST
1072
Wheat germ expression system
25 μg
CFL
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents