missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CRIP1 (Human) Recombinant Protein

Human CRIP1 full-length ORF ( AAH02738, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00001396-P01.10ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16123511

  • 310.00€ / 10µg

Expédition estimée
21-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Spécification

Spécification

AAH02738
cysteine-rich protein 1 (intestinal)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CRIP1
GST
1396
Wheat germ expression system
10 μg
CRHP, CRIP, CRP1, FLJ40971
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents