missing translation for 'onlineSavingsMsg'
Learn More

EIF4E2 Recombinant Protein, Abnova

Marque:  Abnova H00009470-P02.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16123712

  • 467.00€ / 25µg

Expédition estimée
11-01-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Spécification

AAH05392
Solution
9470
EIF4E2 (Human) Recombinant Protein (P02)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EIF4E2
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
52.69
8
Glutathione Sepharose 4 Fast Flow
25 ug
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
4E-LP|4EHP|EIF4EL3|IF4e
EIF4E2
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents