missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GNG7 (Human) Recombinant Protein

Human GNG7 full-length ORF ( AAH14466, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00002788-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16125591

  • 467.00€ / 25µg

Expédition estimée
31-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Spécification

Spécification

AAH14466
guanine nucleotide binding protein (G protein), gamma 7
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GNG7
GST
2788
Wheat germ expression system
25 μg
FLJ00058
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents