missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ANTXR2 Partial ORF (NP_477520.2, 241 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00118429-Q01.10ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16121597

  • 310.00€ / 10µg

Expédition estimée
21-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Sequence: GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIV
Spécification

Spécification

NP_477520.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.44kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIV
RUO
ANTXR2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
118429
ANTXR2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CMG-2|CMG2|FLJ31074|ISH|JHF|MGC111533|MGC45856
ANTXR2
Yes
Vidéos
FDS
Documents