Learn More
Abnova™ Human ARFRP1 Partial ORF (NP_003215, 133 a.a. - 201 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00010139-Q01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
The protein encoded by this gene is a membrane-associated GTP-ase and localizes to the plasma membrane. It is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) genes. The gene is located in a gene cluster that includes the a gene (M68) that is overexpressed in some tumors. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]
Sequence: ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDITSpécification
NP_003215 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.33kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT | |
RUO | |
ARFRP1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
10139 | |
ARFRP1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ARL18/ARP/Arp1 | |
ARFRP1 | |
Recombinant | |
wheat germ expression system |