missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CHRNB2 Partial ORF (NP_000739.1, 26 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
Numéro d’adhésion | NP_000739.1 |
---|---|
À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 1141 |
Poids moléculaire | 37.29kDa |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
16126324
|
Abnova™
H00001141-Q01.25UG |
25 ug |
508.00€
25µg |
Expédition estimée: 29-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
16116324
|
Abnova™
H00001141-Q01.10UG |
10 ug |
335.00€
10µg |
Expédition estimée: 29-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy. [provided by RefSeq]
Sequence: TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSSpécification
NP_000739.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.29kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
EFNL3/nAChRB2 | |
CHRNB2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
1141 | |
CHRNB2 (Human) Recombinant Protein (Q01) | |
TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS | |
RUO | |
CHRNB2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |