missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FTO Full-length ORF (AAH01284.1, 1 a.a. - 139 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00079068-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16124073

  • 467.00€ / 25µg

Expédition estimée
21-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Sequence: MGHPRAIQPSVFFSPYDVHFLLYPIRCPYLKIGRFHIKLKGLHFLFSFLFFFFETQSHSVTRLECSGTISAHCNLCLPGSSNSPASASQVAGTTGTCHHAQLIFVFLAEMGFHHIGQDGLDLNLVIHPPRSPKALGLQA
Spécification

Spécification

AAH01284.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41.8kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA1752|MGC5149
FTO
Yes
wheat germ expression system
Liquid
79068
FTO (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MGHPRAIQPSVFFSPYDVHFLLYPIRCPYLKIGRFHIKLKGLHFLFSFLFFFFETQSHSVTRLECSGTISAHCNLCLPGSSNSPASASQVAGTTGTCHHAQLIFVFLAEMGFHHIGQDGLDLNLVIHPPRSPKALGLQA
RUO
FTO
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents