missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HLX1 Partial ORF (NP_068777, 176 a.a. - 279 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00003142-Q01.10ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16126201

  • sur devis / 10µg

Pour délai, nous consulter 03 88 67 14 14

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article ne peut pas être commandé en ligne car le prix de vente peut varier. Pour en savoir plus, veuillez contacter notre service client au 03 88 67 14 14 .


Description

Description

Sequence: FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS
Spécification

Spécification

NP_068777
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.18kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS
RUO
HLX
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3142
HLX1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HB24|HLX1
HLX
Yes
Vidéos
FDS
Documents