missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30201680

Invitrogen™ Human IP3 Receptor 1 (aa 2472-2553) Control Fragment Recombinant Protein

Code produit 30201680
Modifier l'affichage
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30201680 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30201680 Fournisseur Invitrogen™ Code fournisseur RP91255

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1. Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q14643
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3708
Nom Human IP3 Receptor 1 (aa 2472-2553) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène ACV; CLA4; D6Pas2; ENSMUSG00000072853; Gm10429; I145TR; inositol 1,4,5-triphosphate receptor 1; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-trisphosphate receptor 1; inositol 1,4,5-trisphosphate receptor type 1; inositol 1,4,5-trisphosphate receptor, type 1; inositol 1,4,5-trisphosphate-binding protein P400; Insp3r; InsP3R type I; insP3R1; IP3 receptor; IP3 receptor isoform 1; Ip3r; IP-3-R; IP3R 1; IP3R1; Itpr1; Itpr-1; opisthotonus; opt; P400; Pcd6; Pcp1; Pcp-1; PPP1R94; protein PCD-6; protein phosphatase 1, regulatory subunit 94; Purkinje cell protein 1; SCA15; SCA16; SCA29; SI-SIII-SIIA; Type 1 inositol 1,4,5-trisphosphate receptor; type 1 InsP3 receptor
Nom usuel IP3 Receptor 1
Symbole de gène(s) Itpr1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.