missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human JAZF1 Partial ORF (NP_778231, 165 a.a. - 243 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00221895-Q01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized [provided by RefSeq]
Sequence: MNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQSpécification
| NP_778231 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.43kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ | |
| RUO | |
| JAZF1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 221895 | |
| JAZF1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp761K2222/TIP27/ZNF802 | |
| JAZF1 | |
| Recombinant | |
| wheat germ expression system |