missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRPH Partial ORF (NP_006253, 374 a.a. - 470 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marque:  Abnova™ H00005630-Q01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16123505

  • 467.00€ / 25µg

Expédition estimée
12-01-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Sequence: RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Spécification

Spécification

NP_006253
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
RUO
PRPH
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5630
PRPH (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NEF4|PRPH1
PRPH
Yes
Vidéos
FDS
Documents