missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RBBP5 Partial ORF (NP_005048.2, 392 a.a. - 491 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00005929-Q01.10ug

Weitere Details : Poids : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16124165

  • 310.00€ / 10µg

Expédition estimée
21-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Beschreibung

Beschreibung

Sequence: ELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKGSK
Spezifikation

Spezifikation

NP_005048.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKGSK
RUO
RBBP5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5929
RBBP5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RBQ3|SWD1
RBBP5
Yes
Videos
Sicherheitsdatenblatt (SDS)
missing translation for 'documents'