missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RORB Partial ORF (NP_008845, 136 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
Numéro d’adhésion | NP_008845 |
---|---|
À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Identification génétique (Entrez) | 6096 |
Poids moléculaire | 35.53kDa |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
16104495
|
Abnova™
H00006096-Q01.25UG |
25 ug |
508.00€
25µg |
Expédition estimée: 31-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
16194485
|
Abnova™
H00006096-Q01.10UG |
10 ug |
335.00€
10µg |
Expédition estimée: 31-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation. [provided by RefSeq]
Sequence: ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLSpécification
NP_008845 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.53kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NR1F2/ROR-BETA/RZR-BETA/RZRB/bA133M9.1 | |
RORB | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6096 | |
RORB (Human) Recombinant Protein (Q01) | |
ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHL | |
RUO | |
RORB | |
Wheat Germ (in vitro) | |
GST | |
Liquid |