missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TLR2 Partial ORF (AAH33756.1, 201 a.a. - 300 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
| Numéro d’adhésion | AAH33756.1 |
|---|---|
| À utiliser avec (application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formule | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Identification génétique (Entrez) | 7097 |
| Poids moléculaire | 36.63kDa |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
16004905
|
Abnova™
H00007097-Q02.25UG |
25 ug |
508.00€
25µg |
Expédition estimée: 28-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
|
16094895
|
Abnova™
H00007097-Q02.10UG |
10 ug |
335.00€
10µg |
Expédition estimée: 28-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. [provided by RefSeq]
Sequence: SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNSpécification
| AAH33756.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD282/TIL4 | |
| TLR2 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 7097 | |
| TLR2 (Human) Recombinant Protein (Q02) | |
| SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN | |
| RUO | |
| TLR2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |