Learn More
Abnova™ Human TTC4 Partial ORF (NP_004614.2, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00007268-Q01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
The 34-amino acid tetratricopeptide repeat (TPR) motif is found in a variety of proteins and may mediate protein-protein or protein-membrane interactions.[supplied by OMIM]
Sequence: MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMTRAPSEIDPRENPDLACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISpécification
NP_004614.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMTRAPSEIDPRENPDLACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVI | |
RUO | |
TTC4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
7268 | |
TTC4 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp781B0622/FLJ41930/MGC5097 | |
TTC4 | |
Recombinant | |
wheat germ expression system |