Abnova™ NAT8 Recombinant Protein

Name: Abnova&trade; NAT8 Recombinant Protein
Brand: Abnova&trade;
SKU: 16123202
Price: 335.00 EUR

Marque: Abnova™ H00009027-P01.10ug

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16123202

Expédition estimée: 29-05-2024
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Numéro d’adhésion	AAH12626
Formule	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Poids moléculaire	50.71
Plage de pH	8
Méthode de purification	Glutathione Sepharose 4 Fast Flow
Quantité	10 ug
Immunogène	MAPCHVRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSQ
Alias de gène	CML1/GLA/Hcml1/TSC501/TSC510
Symbole de gène(s)	NAT8
Espèces	Wheat Germ (in vitro)
Marqueur de protéine	GST

À utiliser avec (application)	Antibody Production, Protein Array, ELISA, Western Blot
Identification génétique (Entrez)	9027
Nom	NAT8 (Human) Recombinant Protein (P01)
Méthode de préparation	In vitro wheat germ expression system
Test du contrôle qualité	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nom usuel	NAT8
Réactivité croisée	Human
Recombinant	Recombinant
Forme	Solution

Suggestions de produits

Description