missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NPHS1 (Human) Recombinant Protein

Human NPHS1 partial ORF ( NP_004637.1, 33 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00004868-Q01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16152045

  • 545.00€ / 25µg
Expédition estimée: 13-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
Spécification

Spécification

NP_004637.1
nephrosis 1, congenital, Finnish type (nephrin)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NPHS1
GST
4868
Wheat germ expression system
25 μg
CNF, NPHN
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents
Certificats
Promotions

Promotions