missing translation for 'onlineSavingsMsg'
Learn More

POLD4 Recombinant Protein, Abnova

Marque:  Abnova H00057804-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16122993

  • 467.00€ / 25µg

Expédition estimée
31-12-2020

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Spécification

AAH01334
Solution
57804
POLD4 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
POLD4
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
29.48
8
Glutathione Sepharose 4 Fast Flow
25 ug
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
POLDS|p12
POLD4
Wheat Germ (in vitro)
GST
Vidéos
FDS
Documents