missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PPP1CA (Human) Recombinant Protein

Human PPP1CA full-length ORF ( AAH08010.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00005499-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16123165

  • 467.00€ / 25µg

Expédition estimée
12-01-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Spécification

Spécification

AAH08010.1
protein phosphatase 1, catalytic subunit, alpha isoform
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PPP1CA
GST
5499
Wheat germ expression system
25 μg
MGC15877, MGC1674, PP-1A, PPP1A
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents