missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Hepatitis B HBsAg preS1 Protein
A cDNA sequence encoding the HBsAg preS1 was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP12128-10ug
Informations supplémentaires : Poids : 0.01000kg
Spécification
| Hepatitis B HBsAg preS1 Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA | |
| HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
| 10 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Hepatitis B | |
| Untagged | |
| HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4, and 50mM NaCl. |