missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis B HBsAg preS1 Protein

A cDNA sequence encoding the HBsAg preS1 was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12128-10ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15969458

Quantité Prix
1 114.77€ / 10µg
10 107.33€ / 10µg
Date d’expédition estimée: 22-11-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!



Description

Description

Spécification

Spécification

Hepatitis B HBsAg preS1 Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis B
Untagged
HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4, and 50mM NaCl.
HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
Vidéos
FDS
Documents
Certificats