missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human HGF B Protein

A cDNA sequence encoding the HGF B was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12230-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15969768

  • 6045.80€ / 1mg

Date d’expédition estimée: 25-11-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

HGF B Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
HGF-B protein is supplied in 25mM Na. Acetate, pH 4.8, 1mM EDTA and 50% glycerol.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Vidéos
FDS
Documents
Certificats