missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human LR3 IGF1 Protein
A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.
131.00€ - 264.00€
Spécification
| Nom | LR3 IGF1 Protein |
|---|---|
| État réglementaire | Research Use Only |
| Concentration en endotoxines | < 1.0 EU per ug protein as determined by the LAL method. |
| Activité biologique | The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. |
| Type de produit | Recombinant Protein |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
15945128
|
enQuireBio™
QP10775-200UG |
200 μg |
131.00€
200µg |
Expédition estimée: 31-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
|
15955128
|
enQuireBio™
QP10775-500UG |
500 μg |
179.00€
500µg |
Expédition estimée: 31-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
|
15935128
|
enQuireBio™
QP10775-1MG |
1 mg |
264.00€
1mg |
Expédition estimée: 31-05-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Spécification
| LR3 IGF1 Protein | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| Recombinant Protein | |
| E. coli | |
| MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA | |
| Greater than 95.0% as determined by SDS-PAGE and HPLC. |
| Research Use Only | |
| The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. | |
| Human | |
| Untagged | |
| Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS. |