missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PROC Protein

A cDNA sequence encoding the PROC was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13151-2ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15972659

Quantité Prix
1 114.77€ / 2µg
10 107.33€ / 2µg
Date d’expédition estimée: 25-11-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!



Description

Description

Spécification

Spécification

5624
Greater than 80.0% as determined by SDS-PAGE.
Research Use Only
PROC
Human
His
PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
PROC Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
HEK 293
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW QVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIK EVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGW GYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE GDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAP QKSWAPEFHHHHHHHHThe first 32 amino acids are predicted as signal peptide
Vidéos
FDS
Documents
Certificats