missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse IL 17 A/F Protein

A cDNA sequence encoding the IL 17 A/F was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12392-2ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15970269

Quantité Prix
1 114.77€ / 2µg
10 107.33€ / 2µg
Date d’expédition estimée: 30-11-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!



Description

Description

Spécification

Spécification

IL 17 A/F Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Mouse
Untagged
Lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Greater than 97.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Vidéos
FDS
Documents
Certificats