missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Pramlintide Protein

A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13132-25mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15962599

Quantité Prix
1 633.84€ / 25mg
5 594.29€ / 25mg
Date d’expédition estimée: 25-11-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!



Description

Description

Spécification

Spécification

Pramlintide Protein
25 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
The protein was lyophilized with no additives.
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Vidéos
FDS
Documents
Certificats