missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit GHBP Protein

A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP10642-5ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15964498

Quantité Prix
1 114.77€ / 5µg
10 107.33€ / 5µg
Date d’expédition estimée: 22-11-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!



Description

Description

Spécification

Spécification

GHBP Protein
5 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Greater than 98.0% as determined bySDS-PAGE.
Research Use Only
Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Rabbit
Untagged
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3.
Vidéos
FDS
Documents
Certificats