Learn More
enQuireBio™ Recombinant SARS SARS MERS Protein
A cDNA sequence encoding the SARS MERS was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP13419-1mg
Informations supplémentaires : Poids : 0.01000kg
Spécification
SARS SARS MERS Protein | |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
SARS | |
His | |
SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. |
Protein is >95% pure as determined by 12% PAGE (coomassie staining). | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH |