missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein

A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13965-1mg

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15965259

Quantité Prix
1 1511.71€ / 1mg
3 1421.92€ / 1mg
Date d’expédition estimée: 18-11-2021

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!



Description

Description

Spécification

Spécification

West Nile Virus WNV Pre-M Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
West Nile Virus
His
20mM phosphate buffer pH 7.5.
Protein is >95% pure as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Vidéos
FDS
Documents
Certificats