missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SEMA3B (Human) Recombinant Protein

Human SEMA3B full-length ORF (BAC03823.1, 1 a.a. - 132 a.a.) recombinant protein with GST tag at N-terminal.

Marque:  Abnova™ H00007869-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16152172

  • 545.00€ / 25µg
Expédition estimée: 18-07-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRAVPAARRKEWRPQHVVLRRLVSSRAAGTQGVRRGGQQRLSGV
Spécification

Spécification

BAC03823.1
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SEMA3B
GST
7869
Wheat germ expression system
25 μg
FLJ34863, LUCA-1, SEMA5, SEMAA, SemA, semaV
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents
Certificats
Promotions

Promotions