missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SEMA3B (Human) Recombinant Protein
Human SEMA3B full-length ORF (BAC03823.1, 1 a.a. - 132 a.a.) recombinant protein with GST tag at N-terminal.
Marque: Abnova™ H00007869-P01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
- Sequence: MYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRAVPAARRKEWRPQHVVLRRLVSSRAAGTQGVRRGGQQRLSGV
Spécification
| BAC03823.1 | |
| sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SEMA3B | |
| GST |
| 7869 | |
| Wheat germ expression system | |
| 25 μg | |
| FLJ34863, LUCA-1, SEMA5, SEMAA, SemA, semaV | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |