Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
946,997
résultats
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Applications | Western Blot |
|---|---|
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Concentration | 0.9 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Numéro d’ordre du gène | Q14674 |
| Dilution | Western Blot 1:500 |
| Immunogène | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 9700 |
| Méthode de purification | Protein G purified |
| Disciplines de recherche | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | ESPL1 |
| Alias de gène | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Clone | XJ11-1B12 |
| Antigène | Separase |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Symboles de gène(s) | TP53BP1 |
|---|---|
| Alias de gène | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Goat anti-Mouse IgG (H+L) Secondary Antibody, HRP (Pre-adsorbed), Novus Biologicals™
Goat Polyclonal Antibody has been used in 2 publications
beta-III Tubulin Antibody, Novus Biologicals™
Chicken Polyclonal Antibody has been used in 16 publications
| Applications | Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| État réglementaire | RUO |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, KnockDown Validated |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 5893 |
| Méthode de purification | Affinity Purified |
| Disciplines de recherche | Breast Cancer, DNA Repair, Homologous Recombination |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | RAD52 |
| Alias de gène | DNA repair protein RAD52 homolog, RAD52 (S. cerevisiae) homolog, RAD52 homolog (S. cerevisiae), recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23 |
| Antigène | RAD52 |
| État réglementaire | RUO |
|---|---|
| Espèces hôtes | Rabbit |
| Applications | Immunocytochemistry,Immunofluorescence |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| État réglementaire | RUO |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 1763 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | DNA2 |
| Formule | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gène | DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297 |
| Antigène | DNA2 |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
| Dilution | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
|---|---|
| Immunogène | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
| Isotype | IgG |
| Méthode de purification | Affinity Purified |
| Espèces cibles | Pig,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | MAP1LC3B |
| Contenu et stockage | Store at -20°C. |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 24145 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | PANX1 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529 |
| Antigène | Pannexin-1 |