Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
946,999
résultats
Rabbit IgG Isotype Control, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 36 publications
Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
| Applications | Western Blot |
|---|---|
| Spécificité du test | In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section. |
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Concentration | 1 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at -20°C. Avoid freeze/thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Numéro d’ordre du gène | P16104 |
| Dilution | Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500 |
| Immunogène | This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139. |
| Poids moléculaire de l’antigène | 15 kDa |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 3014 |
| Méthode de purification | Protein G purified |
| Disciplines de recherche | Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | H2AFX |
| Alias de gène | H2A.X, H2A/X, H2AFX |
| Clone | 3F2 |
| Antigène | Histone H2AX (p Ser139) |
| Poids moléculaire | 33.4 kDa |
|---|---|
| Protéine | Protein A |
| Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Catégorie de recherche | Epitope Tags |
| Concentration en endotoxines | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Pureté ou qualité | >97% pure by SDS-PAGE and HPLC |
| Reconstitution | Dissolve in distilled water or saline. |
| Identification génétique (Entrez) | 3919448 |
| Concentration | LYOPH |
| Formule | Lyophilized from additive free solution. |
| Alias de gène | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| À utiliser avec (application) | PAGE,Bioactivity,HPLC |
Novus Biologicals™ DHEA ELISA Kit (Colorimetric)
Highly purified and high bioactivity. Generating reliable and reproducible results.
Coagulation Factor III/Tissue Factor Antibody (SN20-16), Novus Biologicals™
Rabbit Monoclonal Antibody
| Isotype | IgG |
|---|---|
| Conjugué | Unconjugated |
| Concentration | 1 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Forme | Purified |
| Dilution | Western Blot 1:100-1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:100-1:500 |
| Immunogène | Synthetic peptide within human Coagulation Factor III/Tissue Factor aa 30-70. (SwissProt: P13726 Human; SwissProt: P20352 Mouse; SwissProt: P42533 Rat) |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 2152 |
| Méthode de purification | Protein A purified |
| Disciplines de recherche | Cancer |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | F3 |
| Formule | TBS (pH7.4), 0.05% BSA, 40% Glycerol with 0.05% Sodium Azide |
| Alias de gène | CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor |
| Clone | SN20-16 |
| Antigène | CoagulationFactorIII/TissueFactor |
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Applications | Western Blot |
|---|---|
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Concentration | 0.9 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Numéro d’ordre du gène | Q14674 |
| Dilution | Western Blot 1:500 |
| Immunogène | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 9700 |
| Méthode de purification | Protein G purified |
| Disciplines de recherche | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | ESPL1 |
| Alias de gène | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Clone | XJ11-1B12 |
| Antigène | Separase |
Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1), Alexa Fluor™ 647, Novus Biologicals™
Mouse Monoclonal Antibody
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human,Mouse |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 10083 |
| Méthode de purification | Affinity Purified |
| Disciplines de recherche | Signal Transduction, Vision |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | USH1C |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein |
| Antigène | USH1C |
MHC class II (I-A/I-E) Antibody (M5/114.15.2), Alexa Fluor™ 750, Novus Biologicals™
Rat Monoclonal Antibody