Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
525,769
résultats

Novus Biologicals Tyrosine Hydroxylase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 147 publications
Novus Biologicals NPLOC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
---|---|
Spécificité du test | Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Conjugué | Unconjugated |
Espèces cibles | Human,Mouse,Rat |
Primaire ou secondaire | Primary |
Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
État réglementaire | RUO |
Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE |
Classification | Polyclonal |
Identification génétique (Entrez) | 55666 |
Méthode de purification | Affinity Purified |
Espèces hôtes | Rabbit |
Symboles de gène(s) | NPLOC4 |
Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Alias de gène | FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae) |
Antigène | NPLOC4 |
Novus Biologicals BATF3 Antibody (841702) [DyLight 405], Novus Biologicals™
Mouse Monoclonal Antibody
Novus Biologicals Factor VIII Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
État réglementaire | RUO |
---|---|
Immunogène | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Applications | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Méthode de purification | Affinity Purified |
Espèces cibles | Mouse,Rat |
Espèces hôtes | Rabbit |
Symboles de gène(s) | F8 |
Antigène | Factor VIII |
Novus Biologicals™ Multi-Species dsRNA ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
Plage de dosage | 1 - 300 ng/ml (0.1 - 30 ng/well) |
---|---|
Synonyme | Double-stranded RNA |
Conditions de stockage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
Cible | Multi-Species |
Type de produit | ELISA Kit (Colorimetric) |
Spécificité | The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence. |
Sensibilité du dosage | 3 ng/ml |
À utiliser avec (application) | ELISA |
Novus Biologicals Syndecan-2/CD362 Antibody (305515R), HRP, Novus Biologicals™
Rat Monoclonal Antibody
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Highly purified and high bioactivity. Generating reliable and reproducible results.
Type de produit | Recombinant Protein |
---|---|
Réactivité croisée | Human |
Conjugué | Unconjugated |
Nom | Human alpha-Synuclein Aggregate Protein |
Source | E.Coli |
À utiliser avec (application) | In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
État réglementaire | RUO |
Immunogène | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Identification génétique (Entrez) | 6622 |
Méthode de purification | >95% pure by SDS-PAGE |
Symbole de gène(s) | SNCA |
Formule | PBS |
Recombinant | Recombinant |
Alias de gène | alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) |
Novus Biologicals™ HGFR/c-MET Antibody (telisotuzumab) - Humanized, Novus Biologicals™
Human Monoclonal Antibody
Applications | Flow Cytometry,ELISA,Functional Assay |
---|---|
Isotype | IgG1 |
Conjugué | Unconjugated |
Espèces cibles | Human |
Primaire ou secondaire | Primary |
Contenu et stockage | Store at -20°C in powder form. Store at -80°C once reconstituted. |
Forme | Purified |
État réglementaire | RUO |
Numéro d’ordre du gène | P08581 |
Immunogène | HGFR/ c-Met |
Classification | Monoclonal |
Reconstitution | Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex. |
Identification génétique (Entrez) | 4233 |
Méthode de purification | Protein A purified |
Disciplines de recherche | Cancer, Cancer Stem Cells, Cell Cycle and Replication, Cellular Markers, Oncogenes, Phospho Specific, Protein Kinase, Signal Transduction, Tyrosine Kinases |
Espèces hôtes | Human |
Formule | Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2) |
Alias de gène | AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP2, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met |
Clone | telisotuzumab |
Antigène | HGFR/c-MET |
Novus Biologicals Senataxin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
Protéine | HMGB1/HMG-1 |
---|---|
Numéro d’adhésion | P09429, P09429, P09429 |
Catégorie de recherche | Cellular Markers, Chromatin Research, Neuroscience |
Concentration en endotoxines | Less than 1 EU/ug of HMGB1/HMG-1 as determined by LAL method. |
Pureté ou qualité | >95% by SDS-PAGE and HPLC |
Concentration | LYOPH |
À utiliser avec (application) | PAGE |
Poids moléculaire | 26 kDa |
Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
Identification génétique (Entrez) | 3146 |
Symbole de gène(s) | HMGB1 |
Formule | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
Alias de gène | Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein |
Novus Biologicals™ Leucine Aminopeptidase (LAP) Activity Assay Kit (Colorimetric)
Assay Kit (Colorimetric)
Novus Biologicals Npas4 Antibody (S408-79), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
Spécificité du test | Detects 90kDa. |
---|---|
Isotype | IgG1 |
Conjugué | Unconjugated |
Espèces cibles | Human,Mouse,Rat |
Concentration | 1 mg/mL |
Primaire ou secondaire | Primary |
Forme | Purified |
État réglementaire | RUO |
Dilution | Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:100, Immunohistochemistry-Frozen |
Immunogène | Fusion protein amino acids 597-802 (C-terminus) of rat Npas4. |
Classification | Monoclonal |
Identification génétique (Entrez) | 266743 |
Méthode de purification | Protein G purified |
Espèces hôtes | Mouse |
Symboles de gène(s) | NPAS4 |
Alias de gène | BHLHE79, bHLHe79neuronal PAS domain-containing protein 4, Class E basic helix-loop-helix protein 79, Le-PAS, neuronal PAS domain protein 4, Neuronal PAS4, NXFHLH-PAS transcription factor NXF, PASD10PAS domain-containing protein 10 |
Clone | S408-79 |
Antigène | Npas4 |