missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCR7 Antibody, R&D Systems™

CCR7 Antibody, R&D Systems™

Product Code. 18611599 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18611599 25 μL 25µL
18224192 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18611599 Fornitore Novus Biologicals N. del fornitore NBP25875325ul
 Restricted Item
Expédition estimée: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

CCR7 Polyclonal specifically detects CCR7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Single Cell Western.
TRUSTED_SUSTAINABILITY

Specifica

Antigen CCR7
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias BLR2C-C chemokine receptor type 7, C-C CKR-7, CC-CKR-7, CCR-7, CD197, CD197 antigen, CDw197CC chemokine receptor 7, chemokine (C-C motif) receptor 7, CMKBR7chemokine (C-C) receptor 7, EBI1EBV-induced G protein-coupled receptor 1, EBV-induced G-protein coupled receptor 1, Epstein-Barr virus induced gene 1, Epstein-Barr virus induced G-protein coupled receptor, Epstein-Barr virus-induced G-protein coupled receptor 1, EVI1, lymphocyte-specific G protein-coupled peptide receptor, MIP-3 beta receptor
Gene Symbols CCR7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Chemokines and Cytokines, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1236
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.