missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD8 Antibody (CL1529), R&D Systems™

CD8 Antibody (CL1529), R&D Systems™

Product Code. 18608625 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18608625 25 μL 25µL
18173519 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18608625 Supplier Novus Biologicals Supplier No. NBP23674325ul
 Restricted Item
Expédition estimée: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD8
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL1529
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P01732
Gene Alias CD8, CD8a molecule, LEU2, p32
Gene Symbols CD8A
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 925
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG1
Product Line Novus
Show More Show Less

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.