missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ DDT (Human) Recombinant Protein
Description
- Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Spécification
Spécification
| Numéro d’adhésion | AAH05971 |
| Identification génétique (Entrez) | 1652 |
| Nom | D-dopachrome tautomerase |
| Méthode de préparation | Wheat germ expression system |
| Test du contrôle qualité | 125% SDS-PAGE Stained with Coomassie Blue |
| Quantité | 10 μg |
| Conditions de stockage | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Alias de gène | DDCT |
| Symbole de gène(s) | DDT |
| Espèces | Wheat Germ (in vitro) |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?