missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ DDT (Human) Recombinant Protein

Abnova™ DDT (Human) Recombinant Protein

Product Code. p-7164174
Change view
Click to view available options
Quantité:
10 μg
25 μg
Unit Size:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité unitSize
16123981 10 μg 10µg
16133981 25 μg 25µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 16123981 Supplier Abnova™ Supplier No. H00001652P01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Human DDT full-length ORF ( AAH05971, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

Specifications

Numéro d’adhésion AAH05971
Identification génétique (Entrez) 1652
Nom D-dopachrome tautomerase
Méthode de préparation Wheat germ expression system
Test du contrôle qualité 125% SDS-PAGE Stained with Coomassie Blue
Quantité 10 μg
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène DDCT
Symbole de gène(s) DDT
Espèces Wheat Germ (in vitro)
Marqueur de protéine GST
Tampon 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.