missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18607565

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - IHC-Prediluted, R&D Systems™

Produktkode 18607565 Shop alle Bio Techne produkter
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
7 mL
Förpackningsstorlek:
7mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkode Quantity Förpackningsstorlek
18607565 7 mL 7mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Denne vare kan ikke returneres. Se returpolitik
Produktkode 18607565 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP244381
 Restricted Item
Expédition estimée: 26-11-2026
Tilføj til indkøbskurv
Tilføj til indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen DOG1/TMEM16A
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone DG1/447 + DOG-1.1
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 0.25 - 0.5 μg/mL
Formulation 10 mM PBS with 0.05% BSA
Gene Alias ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Host Species Mouse
Immunogen Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Purification Method Protein A or G purified
Quantity 7 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55107
Target Species Human
Content And Storage Store at 4°C.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Product Line Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.