missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30203083

Invitrogen™ Human AP5M1 (aa 167-258) Control Fragment Recombinant Protein

Code produit 30203083
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30203083 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30203083 Fournisseur Invitrogen™ Code fournisseur RP101779

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63401 (PA5-63401. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As part of AP-5, a probable fifth adaptor protein complex it may be involved in endosomal transport. According to PubMed:18395520, it may play a role in cell death. [UniProt]
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9H0R1
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 55745
Nom Human AP5M1 (aa 167-258) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène adapter-related protein complex 5 mu subunit; adapter-related protein complex 5 subunit mu-1; adaptor related protein complex 5 mu 1 subunit; adaptor related protein complex 5, mu 1 subunit; adaptor-related protein complex 5 subunit mu-1; adaptor-related protein complex 5, mu 1 subunit; AP-5 complex subunit mu; AP-5 complex subunit mu-1; AP5M1; C14orf108; MHD domain-containing death-inducing protein; Mu-2 related death-inducing; MU-2/AP1M2 domain containing, death-inducing; mu-2-related death-inducing protein; Mu5; MuD; MUDENG; Putative HIV-1 infection-related protein
Nom usuel AP5M1
Symbole de gène(s) AP5M1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence CPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPT
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.